![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Jeotgalicoccus sp. [TaxId:946435] [229305] (5 PDB entries) |
![]() | Domain d5m0pb_: 5m0p B: [328103] Other proteins in same PDB: d5m0pa2 automated match to d4l54a_ complexed with dcr, hem, na |
PDB Entry: 5m0p (more details), 1.95 Å
SCOPe Domain Sequences for d5m0pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5m0pb_ a.104.1.0 (B:) automated matches {Jeotgalicoccus sp. [TaxId: 946435]} atlkrdkgldntlkvlkqgylyttnqrnrlntsvfqtkalggkpfvvvtgkegaemfynn dvvqregmlpkrivntlagkgaihtvdgkkhvdrkalfmslmtegnlnyvreltrtlwha ntqrmesmdevniyresivlltkvgtrwagvqappedieriatdmdimidsfralggafk gykaskearrrvedwleeqiietrkgnihppegtalyefahwedylgnpmdsrtcaidlm ntfrpliainrfvsfglhamnenpitrekiksepdyaykfaqevrryypfvpflpgkakv didfqgvtipagvglaldvygtthdeslwddpnefrperfetwdgspfdlipqgggdywt nhrcagewitviimeetmkyfaekitydvpeqdlevdlnsipgyvksgfviknvrevvdr t
Timeline for d5m0pb_: