SCOPe 2.08: Domain d5maja_: 5maj A:

Lineage for d5maja_ (5maj A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.0: automated matches [191342] (1 protein)
   not a true family

6. Protein automated matches [190230] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries)

8. Domain d5maja_: 5maj A: [328098]
   automated match to d3of9a_
   complexed with 7kh, edo

Details for d5maja_

PDB Entry: 5maj, 1 Å

PDB Description: cathepsin l in complex with 4-[cyclopentyl(imidazo[1,2-a]pyridin-2- ylmethyl)amino]-6-morpholino-1,3,5-triazine-2-carbonitrile

PDB Compounds: (A:) Cathepsin L1

SCOPe Domain Sequences for d5maja_:

Sequence, based on SEQRES records:

>d5maja_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Sequence, based on observed residues (ATOM records):

>d5maja_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestsdnnk
ywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv

Timeline for d5maja_:

• d5maja_ first appeared in SCOPe 2.06
  
• d5maja_ appears in SCOPe 2.07