SCOPe 2.06: Domain d5iy5i_: 5iy5 I:

Lineage for d5iy5i_ (5iy5 I:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family)
   automatically mapped to Pfam PF02937

5. Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81412] (37 PDB entries)

8. Domain d5iy5i_: 5iy5 I: [328058]
   Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_
   automated match to d1v54i_
   complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5i_

PDB Entry: 5iy5, 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution

PDB Compounds: (I:) Cytochrome c oxidase subunit 6C

SCOPe Domain Sequences for d5iy5i_:

Sequence; same for both SEQRES and ATOM records:

>d5iy5i_ f.23.3.1 (I:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]}
stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf
eemrkagifqsak

Timeline for d5iy5i_:

• d5iy5i_ is new in SCOPe 2.06-stable
  
• d5iy5i_ appears in SCOPe 2.07
  
• d5iy5i_ appears in the current release, SCOPe 2.08