Lineage for d5kzea_ (5kze A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2098336Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2098337Protein automated matches [190115] (75 species)
    not a true protein
  7. 2098822Species Staphylococcus aureus [TaxId:367830] [327973] (2 PDB entries)
  8. 2098823Domain d5kzea_: 5kze A: [328051]
    automated match to d4ahob_
    complexed with gol, so4

Details for d5kzea_

PDB Entry: 5kze (more details), 1.74 Å

PDB Description: n-acetylneuraminate lyase from methicillin-resistant staphylococcus aureus
PDB Compounds: (A:) n-acetylneuraminate lyase

SCOPe Domain Sequences for d5kzea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kzea_ c.1.10.0 (A:) automated matches {Staphylococcus aureus [TaxId: 367830]}
nkdlkglyaallvpfdengqvneqglkqiaqnaieteeldglyvngssgenfllnteqkk
qvfkvakeavgdkvkliaqvgsldlneaielgkyatelgydalsavtpfyypftfeeird
yyfdiieatqnnmiiyaipdltgvnisieqfselfnhekivgvkytapnffllerirkaf
pdklilsgfdemlvqatisgvdgaigstynvngrrarkifdlarqgqiqeayqlqhdsnd
iietvlsmgiyptlkeilrhrgidaglpkrpfkpfneahrqtldqliakydl

SCOPe Domain Coordinates for d5kzea_:

Click to download the PDB-style file with coordinates for d5kzea_.
(The format of our PDB-style files is described here.)

Timeline for d5kzea_: