| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
| Protein automated matches [190154] (92 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries) |
| Domain d5hdkc1: 5hdk C:7-110 [328042] Other proteins in same PDB: d5hdka2, d5hdkb2, d5hdkc2, d5hdkd2 automated match to d1hksa_ complexed with cl, k, na |
PDB Entry: 5hdk (more details), 1.32 Å
SCOPe Domain Sequences for d5hdkc1:
Sequence, based on SEQRES records: (download)
>d5hdkc1 a.4.5.0 (C:7-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrk
>d5hdkc1 a.4.5.0 (C:7-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhigpvefqhpyfkqgqddllenikrk
Timeline for d5hdkc1: