Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
Protein automated matches [190417] (37 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [328012] (5 PDB entries) |
Domain d5m07b_: 5m07 B: [328041] automated match to d1o6ya_ complexed with na; mutant |
PDB Entry: 5m07 (more details), 2.5 Å
SCOPe Domain Sequences for d5m07b_:
Sequence, based on SEQRES records: (download)
>d5m07b_ d.144.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta vagaldyahqrgllhrdvnpanvvltsqsagdqrilladfgiasqpsypapelsagadvd gradqyalaltaihlfagappvdrshtgplqppklsafrpdlarldgvlsralatapadr fgscrefadamneqag
>d5m07b_ d.144.1.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} malasgvtfagytvvrmlgasamgevylvqhpgfpgwqalkvlspamaaddefrrrfqre tevaarlfhphilevhdrgefdgqlwiamdyvdgidatqhmadrfpavlpvgevlaivta vagaldyahqrgllhrdvnpanvvltsqrilladfgiasqpsypapelsagadvdgradq yalaltaihlfagappvdrslqppklsafrpdlarldgvlsralatapadrfgscrefad amneqag
Timeline for d5m07b_: