Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies) two antiparallel transmembrane helices |
Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) |
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) |
Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries) |
Domain d5iy5o1: 5iy5 O:1-90 [328039] Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ automated match to d1v54b2 complexed with cdl, chd, cu, cua, dmu, edo, hea, hec, mg, na, pek, per, pgv, psc, tgl, unl, zn |
PDB Entry: 5iy5 (more details), 2 Å
SCOPe Domain Sequences for d5iy5o1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iy5o1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]} maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe vetiwtilpaiililialpslrilymmdei
Timeline for d5iy5o1:
View in 3D Domains from other chains: (mouse over for more information) d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ |