SCOPe 2.06: Domain d5jegb1: 5jeg B:3-260

Lineage for d5jegb1 (5jeg B:3-260)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
   automatically mapped to Pfam PF00194

6. Protein Carbonic anhydrase [51071] (10 species)

7. Species Human (Homo sapiens), erythrocytes, isozyme II [TaxId:9606] [51073] (682 PDB entries)
   Uniprot P00918

8. Domain d5jegb1: 5jeg B:3-260 [328027]
   Other proteins in same PDB: d5jegb2
   automated match to d2foua_
   complexed with evf, zn

Details for d5jegb1

PDB Entry: 5jeg, 1.19 Å

PDB Description: human carbonic anhydrase ii (v121i) complexed with benzo[d]thiazole-2- sulfonamide

PDB Compounds: (B:) Carbonic anhydrase 2

SCOPe Domain Sequences for d5jegb1:

Sequence; same for both SEQRES and ATOM records:

>d5jegb1 b.74.1.1 (B:3-260) Carbonic anhydrase {Human (Homo sapiens), erythrocytes, isozyme II [TaxId: 9606]}
hhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslrilnn
ghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhlih
wntkygdfgkavqqpdglavlgiflkvgsakpglqkvvdvldsiktkgksadftnfdprg
llpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelmvd
nwrpaqplknrqikasfk

Timeline for d5jegb1:

• d5jegb1 is new in SCOPe 2.06-stable
  
• d5jegb1 appears in SCOPe 2.07
  
• d5jegb1 appears in the current release, SCOPe 2.08