SCOPe 2.08: Domain d5ezlb2: 5ezl B:132-237

Lineage for d5ezlb2 (5ezl B:132-237)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5ezlb2: 5ezl B:132-237 [328015]
   Other proteins in same PDB: d5ezla_, d5ezlh_
   automated match to d2f5al2
   complexed with nag

Details for d5ezlb2

PDB Entry: 5ezl, 2.43 Å

PDB Description: crystal structure of fab of parasite invasion inhibitory antibody c1 - monoclinic form

PDB Compounds: (B:) Fab c12

SCOPe Domain Sequences for d5ezlb2:

Sequence; same for both SEQRES and ATOM records:

>d5ezlb2 b.1.1.0 (B:132-237) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d5ezlb2:

• d5ezlb2 first appeared in SCOPe 2.06
  
• d5ezlb2 appears in SCOPe 2.07