SCOPe 2.08: Domain d5h35g1: 5h35 G:1-112

Lineage for d5h35g1 (5h35 G:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d5h35g1: 5h35 G:1-112 [328009]
   Other proteins in same PDB: d5h35b2, d5h35g2, d5h35i2
   automated match to d1t66c1
   complexed with gol, na, px4

Details for d5h35g1

PDB Entry: 5h35, 2.64 Å

PDB Description: crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus

PDB Compounds: (G:) Fab light chain

SCOPe Domain Sequences for d5h35g1:

Sequence; same for both SEQRES and ATOM records:

>d5h35g1 b.1.1.1 (G:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik

Timeline for d5h35g1:

• d5h35g1 first appeared in SCOPe 2.06
  
• d5h35g1 appears in SCOPe 2.07