![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d5h35b2: 5h35 B:113-217 [327968] Other proteins in same PDB: d5h35a_, d5h35b1, d5h35f_, d5h35g1, d5h35h_, d5h35i1 automated match to d1t66c2 complexed with gol, na, px4 |
PDB Entry: 5h35 (more details), 2.64 Å
SCOPe Domain Sequences for d5h35b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h35b2 b.1.1.2 (B:113-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d5h35b2: