Lineage for d5h35b1 (5h35 B:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2745172Domain d5h35b1: 5h35 B:1-112 [327967]
    Other proteins in same PDB: d5h35b2, d5h35g2, d5h35i2
    automated match to d1t66c1
    complexed with gol, na, px4

Details for d5h35b1

PDB Entry: 5h35 (more details), 2.64 Å

PDB Description: crystal structures of the tric trimeric intracellular cation channel orthologue from sulfolobus solfataricus
PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d5h35b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h35b1 b.1.1.1 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divmtqtplslpvslgdqasiscrssqfivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpwtfgggtkleik

SCOPe Domain Coordinates for d5h35b1:

Click to download the PDB-style file with coordinates for d5h35b1.
(The format of our PDB-style files is described here.)

Timeline for d5h35b1: