| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
| Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
| Protein automated matches [190543] (131 species) not a true protein |
| Species Exiguobacterium antarcticum [TaxId:1087448] [327921] (1 PDB entry) |
| Domain d5h3ha_: 5h3h A: [327966] automated match to d1zoia_ complexed with f50 |
PDB Entry: 5h3h (more details), 1.9 Å
SCOPe Domain Sequences for d5h3ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h3ha_ c.69.1.0 (A:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}
mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
evfeesghgmflderekftetlvsyvks
Timeline for d5h3ha_: