SCOPe 2.08: Domain d5h3ha_: 5h3h A:

Lineage for d5h3ha_ (5h3h A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Exiguobacterium antarcticum [TaxId:1087448] [327921] (1 PDB entry)

8. Domain d5h3ha_: 5h3h A: [327966]
   automated match to d1zoia_
   complexed with f50

Details for d5h3ha_

PDB Entry: 5h3h, 1.9 Å

PDB Description: esterase (eaest) from exiguobacterium antarcticum

PDB Compounds: (A:) Abhydrolase domain-containing protein

SCOPe Domain Sequences for d5h3ha_:

Sequence; same for both SEQRES and ATOM records:

>d5h3ha_ c.69.1.0 (A:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}
mgtfiqavdgtkiyvedigsgqpvvmlhgwpannnmfeyqknrlleegyryigvdyrgyg
ksdapatgydyttmasdineviqqlkltnvtllgfsmgggialkyllnhgesnvsklila
gaaapvftqrdgypygmtkdevdaliedtkqdrpsmlkgfgeiffakehpeplqqwfhnl
svdasshgtiqsaialrdedlrdglpkitvdtlimhgkkdqvcpfefaevmheniagsrl
evfeesghgmflderekftetlvsyvks

Timeline for d5h3ha_:

• d5h3ha_ first appeared in SCOPe 2.06
  
• d5h3ha_ appears in SCOPe 2.07