SCOPe 2.08: Domain d5hfmc1: 5hfm C:539-656

Lineage for d5hfmc1 (5hfm C:539-656)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.2: Virus ectodomain [58069] (2 families)

5. Family h.3.2.1: Virus ectodomain [58070] (9 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (4 species)
   coiled coil; biological unit: trimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)

8. Domain d5hfmc1: 5hfm C:539-656 [327963]
   Other proteins in same PDB: d5hfma2, d5hfmb2, d5hfmc2, d5hfmd2, d5hfme2, d5hfmf2
   automated match to d3cyoa_
   complexed with tam

Details for d5hfmc1

PDB Entry: 5hfm, 2.3 Å

PDB Description: gp41-targeting hiv-1 fusion inhibitors with hook-like ile-asp-leu tail

PDB Compounds: (C:) Envelope glycoprotein gp160,gp41 CHR region

SCOPe Domain Sequences for d5hfmc1:

Sequence, based on SEQRES records:

>d5hfmc1 h.3.2.1 (C:539-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
vqarqllsgivqqqnnllraieaqqhllqltvwgikqlqarilsggrggweewdkkieey
tkkieelikksqnqqidl

Sequence, based on observed residues (ATOM records):

>d5hfmc1 h.3.2.1 (C:539-656) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
vqarqllsgivqqqnnllraieaqqhllqltvwgikqlqariggrggweewdkkieeytk
kieelikksqnqqidl

Timeline for d5hfmc1:

• d5hfmc1 first appeared in SCOPe 2.06
  
• d5hfmc1 appears in SCOPe 2.07