Lineage for d5fvga_ (5fvg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2940626Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2940627Protein automated matches [190526] (26 species)
    not a true protein
  7. 2941021Species Lobophyllia hemprichii [TaxId:46758] [187486] (25 PDB entries)
  8. 2941047Domain d5fvga_: 5fvg A: [327962]
    Other proteins in same PDB: d5fvgb2, d5fvgc2
    automated match to d2vvjc_
    complexed with so4

Details for d5fvga_

PDB Entry: 5fvg (more details), 1.9 Å

PDB Description: structure of irisfp at 100 k.
PDB Compounds: (A:) Green to red photoconvertible GFP-like protein EosFP

SCOPe Domain Sequences for d5fvga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fvga_ d.22.1.0 (A:) automated matches {Lobophyllia hemprichii [TaxId: 46758]}
msaikpdmkinlrmegnvnghhfvidgdgtgkpfegkqsmdlevkeggplpfafdiltta
fhygnrvfaeypdhiqdyfkqsfpkgyswersltfedggiciarnditmegdtfynkvrf
hgvnfpangpvmqkktlkwepstekmyvrdgvltgditmalllegnahyrcdsrttykak
ekgvklpgyhlvdhcieilshdkdynkvklyehavahsglpdn

SCOPe Domain Coordinates for d5fvga_:

Click to download the PDB-style file with coordinates for d5fvga_.
(The format of our PDB-style files is described here.)

Timeline for d5fvga_: