Lineage for d5hdkb1 (5hdk B:7-110)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2306394Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2307971Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2307972Protein automated matches [190154] (87 species)
    not a true protein
  7. 2308186Species Human (Homo sapiens) [TaxId:9606] [186924] (22 PDB entries)
  8. 2308190Domain d5hdkb1: 5hdk B:7-110 [327928]
    Other proteins in same PDB: d5hdka2, d5hdkb2, d5hdkc2, d5hdkd2
    automated match to d1hksa_
    complexed with cl, k, na

Details for d5hdkb1

PDB Entry: 5hdk (more details), 1.32 Å

PDB Description: crystal structure of heat shock factor 2-dbd
PDB Compounds: (B:) Heat shock factor protein 2

SCOPe Domain Sequences for d5hdkb1:

Sequence, based on SEQRES records: (download)

>d5hdkb1 a.4.5.0 (B:7-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrk

Sequence, based on observed residues (ATOM records): (download)

>d5hdkb1 a.4.5.0 (B:7-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhigpvefqhpyfkqgqddllenikrk

SCOPe Domain Coordinates for d5hdkb1:

Click to download the PDB-style file with coordinates for d5hdkb1.
(The format of our PDB-style files is described here.)

Timeline for d5hdkb1: