Lineage for d5iy5r_ (5iy5 R:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2011125Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
    automatically mapped to Pfam PF02284
  5. 2011126Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)
  6. 2011197Protein automated matches [254653] (1 species)
    not a true protein
  7. 2011198Species Cow (Bos taurus) [TaxId:9913] [255695] (2 PDB entries)
  8. 2011202Domain d5iy5r_: 5iy5 R: [327927]
    Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_
    automated match to d1ocre_
    complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn

Details for d5iy5r_

PDB Entry: 5iy5 (more details), 2 Å

PDB Description: electron transfer complex of cytochrome c and cytochrome c oxidase at 2.0 angstrom resolution
PDB Compounds: (R:) cytochrome c oxidase subunit 5a, mitochondrial

SCOPe Domain Sequences for d5iy5r_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iy5r_ a.118.11.1 (R:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOPe Domain Coordinates for d5iy5r_:

Click to download the PDB-style file with coordinates for d5iy5r_.
(The format of our PDB-style files is described here.)

Timeline for d5iy5r_: