| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families) ![]() automatically mapped to Pfam PF02284 |
| Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins) |
| Protein automated matches [254653] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [255695] (7 PDB entries) |
| Domain d5iy5r_: 5iy5 R: [327927] Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ automated match to d1ocre_ complexed with cdl, chd, cu, cua, dmu, edo, hea, hec, mg, na, pek, per, pgv, psc, tgl, unl, zn |
PDB Entry: 5iy5 (more details), 2 Å
SCOPe Domain Sequences for d5iy5r_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iy5r_ a.118.11.1 (R:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv
Timeline for d5iy5r_:
View in 3DDomains from other chains: (mouse over for more information) d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5v_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ |