Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.3: Mitochondrial cytochrome c oxidase subunit VIc [81415] (1 family) automatically mapped to Pfam PF02937 |
Family f.23.3.1: Mitochondrial cytochrome c oxidase subunit VIc [81414] (1 protein) |
Protein Mitochondrial cytochrome c oxidase subunit VIc [81413] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81412] (52 PDB entries) |
Domain d5iy5v_: 5iy5 V: [327915] Other proteins in same PDB: d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ automated match to d1v54i_ complexed with cdl, chd, cu, cua, dmu, edo, hea, hem, mg, na, pek, per, pgv, psc, tgl, unl, zn |
PDB Entry: 5iy5 (more details), 2 Å
SCOPe Domain Sequences for d5iy5v_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iy5v_ f.23.3.1 (V:) Mitochondrial cytochrome c oxidase subunit VIc {Cow (Bos taurus) [TaxId: 9913]} stalakpqmrgllarrlrfhivgafmvslgfatfykfavaekrkkayadfyrnydsmkdf eemrkagifqsak
Timeline for d5iy5v_:
View in 3D Domains from other chains: (mouse over for more information) d5iy51_, d5iy52_, d5iy5a_, d5iy5b1, d5iy5b2, d5iy5c_, d5iy5d_, d5iy5e_, d5iy5f_, d5iy5g_, d5iy5h_, d5iy5i_, d5iy5j_, d5iy5k_, d5iy5l_, d5iy5m_, d5iy5n_, d5iy5o1, d5iy5o2, d5iy5p_, d5iy5q_, d5iy5r_, d5iy5s_, d5iy5t_, d5iy5u_, d5iy5w_, d5iy5x_, d5iy5y_, d5iy5z_ |