Lineage for d5hdkd1 (5hdk D:7-111)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694554Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 2694555Protein automated matches [190154] (92 species)
    not a true protein
  7. 2694784Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)
  8. 2694790Domain d5hdkd1: 5hdk D:7-111 [327909]
    Other proteins in same PDB: d5hdka2, d5hdkb2, d5hdkc2, d5hdkd2
    automated match to d1hksa_
    complexed with cl, k, na

Details for d5hdkd1

PDB Entry: 5hdk (more details), 1.32 Å

PDB Description: crystal structure of heat shock factor 2-dbd
PDB Compounds: (D:) Heat shock factor protein 2

SCOPe Domain Sequences for d5hdkd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hdkd1 a.4.5.0 (D:7-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln
mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkv

SCOPe Domain Coordinates for d5hdkd1:

Click to download the PDB-style file with coordinates for d5hdkd1.
(The format of our PDB-style files is described here.)

Timeline for d5hdkd1: