![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (92 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries) |
![]() | Domain d5hdkd1: 5hdk D:7-111 [327909] Other proteins in same PDB: d5hdka2, d5hdkb2, d5hdkc2, d5hdkd2 automated match to d1hksa_ complexed with cl, k, na |
PDB Entry: 5hdk (more details), 1.32 Å
SCOPe Domain Sequences for d5hdkd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hdkd1 a.4.5.0 (D:7-111) automated matches {Human (Homo sapiens) [TaxId: 9606]} vpaflsklwtlveethtnefitwsqngqsflvldeqrfakeilpkyfkhnnmasfvrqln mygfrkvvhidsgivkqerdgpvefqhpyfkqgqddllenikrkv
Timeline for d5hdkd1: