![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Sphingomonas sp. [TaxId:1112214] [327907] (1 PDB entry) |
![]() | Domain d5h1za_: 5h1z A: [327908] automated match to d3ivya_ complexed with d12, hem |
PDB Entry: 5h1z (more details), 3.1 Å
SCOPe Domain Sequences for d5h1za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5h1za_ a.104.1.0 (A:) automated matches {Sphingomonas sp. [TaxId: 1112214]} vidrfdvsrpelyrddlwqapfrelratapvhrvehsdfgpywsvssykpiitveslpdl yssaggitladfiennptdvrmpmfiamdrpkhtgqrrtvapaftpsemvrmsdnirmrt aevldslewntpfdwvdtvsvelttqmlailfdfpweerrkltfwsdwagdielvkneel rlerlrhmyecggyfqnlwnakigkpptpdlismmihsdamaemdqmeflgnlillivgg ndttrntmsavaygldlfpdqrakleadpsmipntvqeiirwqtplahmrrtatvdsele gqqikagdklalwyisanrdesvfenadriivdrpnarrhlafghgihrcvgarlaelqi avlleemakrrmrvnvlgepervaacfvhgyrklpveisr
Timeline for d5h1za_: