| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) ![]() automatically mapped to Pfam PF00016 |
| Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins) N-terminal domain is alpha+beta |
| Protein automated matches [226984] (9 species) not a true protein |
| Species Rhodopseudomonas palustris [TaxId:1076] [327791] (7 PDB entries) |
| Domain d5hatl2: 5hat L:139-457 [327886] Other proteins in same PDB: d5hata1, d5hatd1, d5hatg1, d5hatj1, d5hatl1 automated match to d4lf2a2 complexed with cap, mg; mutant |
PDB Entry: 5hat (more details), 2 Å
SCOPe Domain Sequences for d5hatl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hatl2 c.1.14.1 (L:139-457) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
gpsttikdlwrvlgrpvinggfivgtiikpklglrpqpfanacydfwlggdfikndepqg
nqvfapfkdtvravadamrraqdktgeaklfsfnitaddhyemlargefiletfadnadh
iaflvdgyvagpaavttarrafpkqylhyhraghgavtspqskrgytafvlskmarlqga
sgihtgtmgfgkaegeaadraiaymitedaadgpyfhqewlgmnpttpiisggmnalrmp
gffdnlghsnlimtagggafghvdggaagakslrqaeqcwkqgadpvefakdhrefaraf
esfpqdadklypnwraklk
Timeline for d5hatl2: