| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) ![]() C-terminal domain is beta/alpha barrel |
| Family d.58.9.0: automated matches [227234] (1 protein) not a true family |
| Protein automated matches [226983] (18 species) not a true protein |
| Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) |
| Domain d5hatl1: 5hat L:1-138 [327885] Other proteins in same PDB: d5hata2, d5hatd2, d5hatg2, d5hatj2, d5hatl2 automated match to d4lf2a1 complexed with cap, mg; mutant |
PDB Entry: 5hat (more details), 2 Å
SCOPe Domain Sequences for d5hatl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hatl1 d.58.9.0 (L:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd
Timeline for d5hatl1: