Lineage for d5hatd1 (5hat D:1-138)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) 
C-terminal domain is beta/alpha barrel
Family d.58.9.0: automated matches [227234] (1 protein)
not a true familyProtein automated matches [226983] (27 species)
not a true protein
Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries) 
Domain d5hatd1: 5hat D:1-138 [327883]
Other proteins in same PDB: d5hata2, d5hatb2, d5hatc2, d5hatd2, d5hate2, d5hatf2, d5hatg2, d5hath2, d5hati2, d5hatj2, d5hatk2, d5hatl2
automated match to d4lf2a1
complexed with cap, mg; mutant
Details for d5hatd1
PDB Entry: 5hat (more details), 2 Å
PDB Description: structure function studies of r. palustris rubisco (s59f/m331a mutant; cabp-bound)
PDB Compounds: (D:) Ribulose bisphosphate carboxylaseSCOPe Domain Sequences for d5hatd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hatd1 d.58.9.0 (D:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd
SCOPe Domain Coordinates for d5hatd1:
Click to download the PDB-style file with coordinates for d5hatd1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5hatd1:
View in 3D
