Lineage for d5tc9a1 (5tc9 A:2-432)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779928Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins)
    contains many insertions in the common fold
    automatically mapped to Pfam PF00840
  6. 2779929Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (8 species)
  7. 2779956Species Hypocrea jecorina [TaxId:431241] [327872] (1 PDB entry)
  8. 2779957Domain d5tc9a1: 5tc9 A:2-432 [327873]
    Other proteins in same PDB: d5tc9a2
    automated match to d1q2ba_
    complexed with gd3, nag, no3

Details for d5tc9a1

PDB Entry: 5tc9 (more details), 1.6 Å

PDB Description: wild type trcel7a catalytic domain in a closed state
PDB Compounds: (A:) glucanase

SCOPe Domain Sequences for d5tc9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tc9a1 b.29.1.10 (A:2-432) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Hypocrea jecorina [TaxId: 431241]}
sactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstlc
pdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqeft
llgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdlk
fingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeicegd
gcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgain
ryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggmv
lvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsni
kfgpigstgnp

SCOPe Domain Coordinates for d5tc9a1:

Click to download the PDB-style file with coordinates for d5tc9a1.
(The format of our PDB-style files is described here.)

Timeline for d5tc9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tc9a2