SCOPe 2.08: Domain d5hata1: 5hat A:1-138

Lineage for d5hata1 (5hat A:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)

8. Domain d5hata1: 5hat A:1-138 [327858]
   Other proteins in same PDB: d5hata2, d5hatb2, d5hatc2, d5hatd2, d5hate2, d5hatf2, d5hatg2, d5hath2, d5hati2, d5hatj2, d5hatk2, d5hatl2
   automated match to d4lf2a1
   complexed with cap, mg; mutant

Details for d5hata1

PDB Entry: 5hat, 2 Å

PDB Description: structure function studies of r. palustris rubisco (s59f/m331a mutant; cabp-bound)

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5hata1:

Sequence; same for both SEQRES and ATOM records:

>d5hata1 d.58.9.0 (A:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevft
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

Timeline for d5hata1:

• d5hata1 first appeared in SCOPe 2.06
  
• d5hata1 appears in SCOPe 2.07