![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
![]() | Protein automated matches [227017] (58 species) not a true protein |
![]() | Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries) |
![]() | Domain d5t6ne1: 5t6n E:11-326 [327856] Other proteins in same PDB: d5t6na2, d5t6nb_, d5t6nc2, d5t6nd_, d5t6ne2, d5t6nf_ automated match to d4xkga_ complexed with 75u, gol, nag, so4 |
PDB Entry: 5t6n (more details), 2.54 Å
SCOPe Domain Sequences for d5t6ne1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t6ne1 b.19.1.0 (E:11-326) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk qntlklatgmrnvpek
Timeline for d5t6ne1: