Lineage for d5haob1 (5hao B:1-138)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2952777Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) (S)
    C-terminal domain is beta/alpha barrel
  5. 2952998Family d.58.9.0: automated matches [227234] (1 protein)
    not a true family
  6. 2952999Protein automated matches [226983] (27 species)
    not a true protein
  7. 2953172Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)
  8. 2953210Domain d5haob1: 5hao B:1-138 [327853]
    Other proteins in same PDB: d5haoa2, d5haob2, d5haoc2, d5haod2, d5haoe2, d5haof2
    automated match to d4lf2a1
    complexed with cap, mg; mutant

Details for d5haob1

PDB Entry: 5hao (more details), 2.18 Å

PDB Description: structure function studies of r. palustris rubisco (m331a mutant; cabp-bound)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5haob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5haob1 d.58.9.0 (B:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

SCOPe Domain Coordinates for d5haob1:

Click to download the PDB-style file with coordinates for d5haob1.
(The format of our PDB-style files is described here.)

Timeline for d5haob1: