Lineage for d5kmvi1 (5kmv I:1-107)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024002Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)
  8. 2024289Domain d5kmvi1: 5kmv I:1-107 [327840]
    Other proteins in same PDB: d5kmvi2
    automated match to d1t66c1
    complexed with epe, mes, so4

Details for d5kmvi1

PDB Entry: 5kmv (more details), 2.5 Å

PDB Description: crystal structure of crenezumab fab
PDB Compounds: (I:) IgG4 light chain

SCOPe Domain Sequences for d5kmvi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kmvi1 b.1.1.1 (I:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqslvysngdtylhwylqkpgqspqlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedvgvyycsqsthvpwtfgqgtkveik

SCOPe Domain Coordinates for d5kmvi1:

Click to download the PDB-style file with coordinates for d5kmvi1.
(The format of our PDB-style files is described here.)

Timeline for d5kmvi1:

  • d5kmvi1 is new in SCOPe 2.06-stable
  • d5kmvi1 does not appear in SCOPe 2.07

2024289
d5kmvi1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d5kmvi2