Lineage for d1a8y_3 (1a8y 229-347)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24200Family c.47.1.3: Calsequestrin [52855] (1 protein)
  6. 24201Protein Calsequestrin [52856] (1 species)
  7. 24202Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (1 PDB entry)
  8. 24205Domain d1a8y_3: 1a8y 229-347 [32783]

Details for d1a8y_3

PDB Entry: 1a8y (more details), 2.4 Å

PDB Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution

SCOP Domain Sequences for d1a8y_3:

Sequence, based on SEQRES records: (download)

>d1a8y_3 c.47.1.3 (229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus)}
tlrklkpesmyetweddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwid
pddfpllvpywektfdidlsapqigvvnvtdadsvwmemddeedlpsaeeledwledvl

Sequence, based on observed residues (ATOM records): (download)

>d1a8y_3 c.47.1.3 (229-347) Calsequestrin {Rabbit (Oryctolagus cuniculus)}
tlrklkpesmyetweddmdgihivafaeeadpdgyefleilksvaqdntdnpdlsiiwid
pddfpllvpywektfdidlsapqigvvnvtdadsvwmepsaeeledwledvl

SCOP Domain Coordinates for d1a8y_3:

Click to download the PDB-style file with coordinates for d1a8y_3.
(The format of our PDB-style files is described here.)

Timeline for d1a8y_3: