Lineage for d5tpxa1 (5tpx A:1356-1460)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708305Species Plasmodium falciparum [TaxId:36329] [237857] (4 PDB entries)
  8. 2708311Domain d5tpxa1: 5tpx A:1356-1460 [327826]
    Other proteins in same PDB: d5tpxa2
    automated match to d4ldfa_
    complexed with 7h7, cl, so4

Details for d5tpxa1

PDB Entry: 5tpx (more details), 2.1 Å

PDB Description: bromodomain from plasmodium faciparum gcn5, complexed with compound
PDB Compounds: (A:) histone acetyltransferase gcn5

SCOPe Domain Sequences for d5tpxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tpxa1 a.29.2.0 (A:1356-1460) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdy
ktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

SCOPe Domain Coordinates for d5tpxa1:

Click to download the PDB-style file with coordinates for d5tpxa1.
(The format of our PDB-style files is described here.)

Timeline for d5tpxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tpxa2