Lineage for d5t6nb_ (5t6n B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041018Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries)
  8. 3041022Domain d5t6nb_: 5t6n B: [327818]
    Other proteins in same PDB: d5t6na1, d5t6na2, d5t6nc1, d5t6nc2, d5t6ne1, d5t6ne2
    automated match to d1qfub_
    complexed with 75u, gol, nag, so4

Details for d5t6nb_

PDB Entry: 5t6n (more details), 2.54 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (B:) hemagglutinin HA2

SCOPe Domain Sequences for d5t6nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6nb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq

SCOPe Domain Coordinates for d5t6nb_:

Click to download the PDB-style file with coordinates for d5t6nb_.
(The format of our PDB-style files is described here.)

Timeline for d5t6nb_: