| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
| Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
| Protein Influenza hemagglutinin (stalk) [58066] (22 species) trimer |
| Species Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId:384505] [327816] (3 PDB entries) |
| Domain d5t6nb_: 5t6n B: [327818] Other proteins in same PDB: d5t6na1, d5t6na2, d5t6nc1, d5t6nc2, d5t6ne1, d5t6ne2 automated match to d1qfub_ complexed with 75u, gol, nag, so4 |
PDB Entry: 5t6n (more details), 2.54 Å
SCOPe Domain Sequences for d5t6nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5t6nb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/northern territory/60/1968 h3n2) [TaxId: 384505]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfq
Timeline for d5t6nb_: