SCOPe 2.05: Domain d1a8ya1: 1a8y A:3-126

Lineage for d1a8ya1 (1a8y A:3-126)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.3: Calsequestrin [52855] (1 protein)
   duplication: contains three tandem repeats of this fold

6. Protein Calsequestrin [52856] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (3 PDB entries)

8. Domain d1a8ya1: 1a8y A:3-126 [32781]

Details for d1a8ya1

PDB Entry: 1a8y, 2.4 Å

PDB Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution

PDB Compounds: (A:) calsequestrin

SCOPe Domain Sequences for d1a8ya1:

Sequence; same for both SEQRES and ATOM records:

>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilelaa
qvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlveflldv
ledp

Timeline for d1a8ya1:

• d1a8ya1 first appeared (with stable ids) in SCOP 1.55, called d1a8y_1
  
• d1a8ya1 appears in SCOPe 2.04
  
• d1a8ya1 appears in SCOPe 2.06
  
• d1a8ya1 appears in the current release, SCOPe 2.08