Lineage for d1a8ya1 (1a8y A:3-126)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 833461Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 833462Superfamily c.47.1: Thioredoxin-like [52833] (23 families) (S)
  5. 833716Family c.47.1.3: Calsequestrin [52855] (1 protein)
    duplication: contains three tandem repeats of this fold
  6. 833717Protein Calsequestrin [52856] (1 species)
  7. 833718Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52857] (1 PDB entry)
  8. 833719Domain d1a8ya1: 1a8y A:3-126 [32781]

Details for d1a8ya1

PDB Entry: 1a8y (more details), 2.4 Å

PDB Description: crystal structure of calsequestrin from rabbit skeletal muscle sarcoplasmic reticulum at 2.4 a resolution
PDB Compounds: (A:) calsequestrin

SCOP Domain Sequences for d1a8ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gldfpeydgvdrvinvnaknyknvfkkyevlallyheppeddkasqrqfemeelilelaa
qvledkgvgfglvdsekdaavakklglteedsiyvfkedevieydgefsadtlveflldv
ledp

SCOP Domain Coordinates for d1a8ya1:

Click to download the PDB-style file with coordinates for d1a8ya1.
(The format of our PDB-style files is described here.)

Timeline for d1a8ya1: