Lineage for d5t6sk_ (5t6s K:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2047495Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2047496Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2048164Family b.19.1.0: automated matches [227246] (1 protein)
    not a true family
  6. 2048165Protein automated matches [227017] (34 species)
    not a true protein
  7. 2048396Species Influenza a virus [TaxId:1332244] [228093] (13 PDB entries)
  8. 2048410Domain d5t6sk_: 5t6s K: [327806]
    Other proteins in same PDB: d5t6sb_, d5t6sd_, d5t6sf_, d5t6sh_, d5t6sj_, d5t6sl_
    automated match to d4n62a_
    complexed with 75u, bma, na, nag

Details for d5t6sk_

PDB Entry: 5t6s (more details), 2.36 Å

PDB Description: crystal structure of the a/shanghai/2/2013 (h7n9) influenza virus hemagglutinin in complex with the antiviral drug arbidol
PDB Compounds: (K:) hemagglutinin HA1

SCOPe Domain Sequences for d5t6sk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t6sk_ b.19.1.0 (K:) automated matches {Influenza a virus [TaxId: 1332244]}
dkiclghhavsngtkvntltergvevvnatetvertnipricskgkrtvdlgqcgllgti
tgppqcdqflefsadliierregsdvcypgkfvneealrqilresggidkeamgftysgi
rtngatsacrrsgssfyaemkwllsntdnaafpqmtksykntrkspalivwgihhsvsta
eqtklygsgnklvtvgssnyqqsfvpspgarpqvnglsgridfhwlmlnpndtvtfsfng
afiapdrasflrgksmgiqsgvqvdancegdcyhsggtiisnlpfqnidsravgkcpryv
kqrslllatgmknvpe

SCOPe Domain Coordinates for d5t6sk_:

Click to download the PDB-style file with coordinates for d5t6sk_.
(The format of our PDB-style files is described here.)

Timeline for d5t6sk_: