SCOPe 2.08: Domain d5haoe1: 5hao E:1-138

Lineage for d5haoe1 (5hao E:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [327788] (7 PDB entries)

8. Domain d5haoe1: 5hao E:1-138 [327790]
   Other proteins in same PDB: d5haoa2, d5haob2, d5haoc2, d5haod2, d5haoe2, d5haof2
   automated match to d4lf2a1
   complexed with cap, mg; mutant

Details for d5haoe1

PDB Entry: 5hao, 2.18 Å

PDB Description: structure function studies of r. palustris rubisco (m331a mutant; cabp-bound)

PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d5haoe1:

Sequence; same for both SEQRES and ATOM records:

>d5haoe1 d.58.9.0 (E:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

Timeline for d5haoe1:

• d5haoe1 first appeared in SCOPe 2.06
  
• d5haoe1 appears in SCOPe 2.07