Lineage for d1hyua3 (1hyu A:1-102)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2484464Family c.47.1.2: PDI-like [52849] (3 proteins)
    duplication: contains two tandem repeats of this fold
  6. 2484465Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species)
  7. 2484466Species Salmonella typhimurium [TaxId:90371] [52854] (3 PDB entries)
  8. 2484467Domain d1hyua3: 1hyu A:1-102 [32779]
    Other proteins in same PDB: d1hyua1, d1hyua2
    complexed with cl, fad, so4

Details for d1hyua3

PDB Entry: 1hyu (more details), 2 Å

PDB Description: crystal structure of intact ahpf
PDB Compounds: (A:) Alkyl hydroperoxide reductase subunit F

SCOPe Domain Sequences for d1hyua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
mldtnmktqlraylekltkpveliatlddsaksaeikellaeiaelsdkvtfkedntlpv
rkpsflitnpgsqqgprfagsplgheftslvlallwtgghps

SCOPe Domain Coordinates for d1hyua3:

Click to download the PDB-style file with coordinates for d1hyua3.
(The format of our PDB-style files is described here.)

Timeline for d1hyua3: