Lineage for d1hyua3 (1hyu A:1-102)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 70801Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 70802Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 70882Family c.47.1.2: PDI-like [52849] (2 proteins)
  6. 70883Protein Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain [52853] (1 species)
  7. 70884Species Salmonella typhimurium [TaxId:90371] [52854] (1 PDB entry)
  8. 70885Domain d1hyua3: 1hyu A:1-102 [32779]
    Other proteins in same PDB: d1hyua1, d1hyua2

Details for d1hyua3

PDB Entry: 1hyu (more details), 2 Å

PDB Description: crystal structure of intact ahpf

SCOP Domain Sequences for d1hyua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium}
mldtnmktqlraylekltkpveliatlddsaksaeikellaeiaelsdkvtfkedntlpv
rkpsflitnpgsqqgprfagsplgheftslvlallwtgghps

SCOP Domain Coordinates for d1hyua3:

Click to download the PDB-style file with coordinates for d1hyua3.
(The format of our PDB-style files is described here.)

Timeline for d1hyua3: