SCOPe 2.06: Domain d5jyld2: 5jyl D:138-242

Lineage for d5jyld2 (5jyl D:138-242)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d5jyld2: 5jyl D:138-242 [327783]
   Other proteins in same PDB: d5jyla_, d5jylc_
   automated match to d1f3rb2
   complexed with cl, gol, po4

Details for d5jyld2

PDB Entry: 5jyl, 2.55 Å

PDB Description: human p-cadherin mec1 with scfv tsp7 bound

PDB Compounds: (D:) scFv TSP7

SCOPe Domain Sequences for d5jyld2:

Sequence; same for both SEQRES and ATOM records:

>d5jyld2 b.1.1.0 (D:138-242) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
idiqmtqttsslsaslgdrvtiscrasqditnylnwyqqkpdgtvklliyytsrlhsgvp
srfsgsgsgtdysltisnleqediatyfcqqdskhprtfgggtkl

Timeline for d5jyld2:

• d5jyld2 is new in SCOPe 2.06-stable
  
• d5jyld2 appears in SCOPe 2.07
  
• d5jyld2 appears in the current release, SCOPe 2.08