Lineage for d1a8l_2 (1a8l 120-226)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24187Family c.47.1.2: PDI-like [52849] (2 proteins)
  6. 24192Protein Protein disulfide isomerase, PDI [52850] (2 species)
  7. 24197Species Pyrococcus furiosus [TaxId:186497] [52852] (1 PDB entry)
  8. 24199Domain d1a8l_2: 1a8l 120-226 [32778]

Details for d1a8l_2

PDB Entry: 1a8l (more details), 1.9 Å

PDB Description: protein disulfide oxidoreductase from archaeon pyrococcus furiosus
PDB Compounds: ( :)

SCOP Domain Sequences for d1a8l_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8l_2 c.47.1.2 (120-226) Protein disulfide isomerase, PDI {Pyrococcus furiosus}
nlmdetkqairnidqdvrilvfvtptcpycplavrmahkfaientkagkgkilgdmveai
eypewadqynvmavpkiviqvngedrvefegaypekmflekllsals

SCOP Domain Coordinates for d1a8l_2:

Click to download the PDB-style file with coordinates for d1a8l_2.
(The format of our PDB-style files is described here.)

Timeline for d1a8l_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8l_1