| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.12.2: PsbU-like [158539] (2 proteins) Pfam PF06514 |
| Protein automated matches [191005] (3 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries) |
| Domain d5kaiu_: 5kai u: [327777] Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiv_, d5kaix_, d5kaiz_ automated match to d2axtu1 complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kai (more details), 2.8 Å
SCOPe Domain Sequences for d5kaiu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kaiu_ a.60.12.2 (u:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk
Timeline for d5kaiu_: