Lineage for d5kaiv_ (5kai v:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981426Family a.3.1.0: automated matches [191374] (1 protein)
    not a true family
  6. 1981427Protein automated matches [190453] (22 species)
    not a true protein
  7. 1981551Species Thermosynechococcus elongatus [TaxId:197221] [327705] (4 PDB entries)
  8. 1981554Domain d5kaiv_: 5kai v: [327775]
    Other proteins in same PDB: d5kaia_, d5kaib_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kaio_, d5kaiu_, d5kaix_, d5kaiz_
    automated match to d1e29a_
    complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kaiv_

PDB Entry: 5kai (more details), 2.8 Å

PDB Description: nh3-bound rt xfel structure of photosystem ii 500 ms after the 2nd illumination (2f) at 2.8 a resolution
PDB Compounds: (v:) cytochrome c-550

SCOPe Domain Sequences for d5kaiv_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kaiv_ a.3.1.0 (v:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy

SCOPe Domain Coordinates for d5kaiv_:

Click to download the PDB-style file with coordinates for d5kaiv_.
(The format of our PDB-style files is described here.)

Timeline for d5kaiv_: