| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.0: automated matches [191374] (1 protein) not a true family |
| Protein automated matches [190453] (26 species) not a true protein |
| Species Thermosynechococcus elongatus [TaxId:197221] [327705] (4 PDB entries) |
| Domain d5kaiv_: 5kai v: [327775] Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaih_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaix_, d5kaiz_ automated match to d1e29a_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kai (more details), 2.8 Å
SCOPe Domain Sequences for d5kaiv_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kaiv_ a.3.1.0 (v:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
aeltpevltvplnsegktitltekqylegkrlfqyacaschvggitktnpsldlrtetla
latpprdnieglvdymknpttydgeqeiaevhpslrsadifpkmrnltekdlvaiaghil
vepkilgdkwgggkvyy
Timeline for d5kaiv_: