SCOPe 2.07: Domain d5kafu_: 5kaf U:

Lineage for d5kafu_ (5kaf U:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.2: PsbU-like [158539] (2 proteins)
   Pfam PF06514

6. Protein automated matches [191005] (3 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [260559] (5 PDB entries)

8. Domain d5kafu_: 5kaf U: [327770]
   Other proteins in same PDB: d5kafa_, d5kafb_, d5kafc_, d5kafd_, d5kafe_, d5kaff_, d5kafh_, d5kafi1, d5kafi2, d5kafj_, d5kafk_, d5kafl_, d5kafm1, d5kafm2, d5kafo_, d5kaft1, d5kaft2, d5kafv_, d5kafx_, d5kafz_
   automated match to d2axtu1
   complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl

Details for d5kafu_

PDB Entry: 5kaf, 3 Å

PDB Description: rt xfel structure of photosystem ii in the dark state at 3.0 a resolution

PDB Compounds: (U:) Photosystem II 12 kDa extrinsic protein

SCOPe Domain Sequences for d5kafu_:

Sequence; same for both SEQRES and ATOM records:

>d5kafu_ a.60.12.2 (U:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
elvnvvdeklgtaygekidlnntniaafiqyrglyptlaklivknapyesvedvlnipgl
terqkqilrenlehftvtevetalveggdrynnglyk

Timeline for d5kafu_:

• d5kafu_ first appeared in SCOPe 2.06
  
• d5kafu_ appears in the current release, SCOPe 2.08