Lineage for d5tise_ (5tis E:)
- Root: SCOPe 2.07
Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) 
Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
not a true fold
Superfamily f.23.38: Cytochrome b559 subunits [161045] (1 family) 
Family f.23.38.1: Cytochrome b559 subunits [161046] (3 proteins)
Pfam PF00283 comprises PsbF beta subunit (PsbF) and the transmembrane helix of alpha subunit (PsbE) that bind one heme group between them; the lumenal region of the alpha subunit is covered by Pfam PF00284
Protein automated matches [191000] (6 species)
not a true protein
Species Thermosynechococcus elongatus [TaxId:197221] [326602] (6 PDB entries) 
Domain d5tise_: 5tis E: [327765]
Other proteins in same PDB: d5tisa_, d5tisb_, d5tisc_, d5tisd_, d5tish_, d5tisi_, d5tisj_, d5tisk_, d5tisl_, d5tism_, d5tiso_, d5tist_, d5tisu_, d5tisv_, d5tisx_, d5tisz_
automated match to d2axte1
complexed with bcr, bct, cl, cla, dgd, fe2, hem, lhg, lmg, oex, pho, pl9, sqd, unl
Details for d5tise_
PDB Entry: 5tis (more details), 2.25 Å
PDB Description: room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
PDB Compounds: (E:) Cytochrome b559 subunit alphaSCOPe Domain Sequences for d5tise_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tise_ f.23.38.1 (E:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
ttgerpfsdiitsvrywvihsitipalfiagwlfvstglaydvfgtprpdsyyaqeqrsi
plvtdrfeakqqvetfleqlk
SCOPe Domain Coordinates for d5tise_:
Click to download the PDB-style file with coordinates for d5tise_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5tise_:
View in 3D
