Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.2: PDI-like [52849] (3 proteins) duplication: contains two tandem repeats of this fold |
Protein Protein disulfide isomerase, PDI [52850] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [52851] (3 PDB entries) |
Domain d2bjxa_: 2bjx A: [32776] C-terminal domain |
PDB Entry: 2bjx (more details)
SCOPe Domain Sequences for d2bjxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} aattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaiddipfgitsnsdvfsk yqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqta
Timeline for d2bjxa_: