SCOPe 2.04: Domain d2bjxa_: 2bjx A:

Lineage for d2bjxa_ (2bjx A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.2: PDI-like [52849] (3 proteins)
   duplication: contains two tandem repeats of this fold

6. Protein Protein disulfide isomerase, PDI [52850] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52851] (3 PDB entries)

8. Domain d2bjxa_: 2bjx A: [32776]
   C-terminal domain

Details for d2bjxa_

PDB Entry: 2bjx

PDB Description: protein disulfide isomerase

PDB Compounds: (A:) protein (protein disulfide isomerase)

SCOPe Domain Sequences for d2bjxa_:

Sequence; same for both SEQRES and ATOM records:

>d2bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]}
aattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaiddipfgitsnsdvfsk
yqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqta

Timeline for d2bjxa_:

• d2bjxa_ first appeared (with stable ids) in SCOP 1.55
  
• d2bjxa_ appears in SCOPe 2.03
  
• d2bjxa_ appears in SCOPe 2.05
  
• d2bjxa_ appears in the current release, SCOPe 2.08