SCOPe 2.06: Domain d5t50b_: 5t50 B:

Lineage for d5t50b_ (5t50 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Bauhinia forficata [TaxId:413686] [327694] (4 PDB entries)

8. Domain d5t50b_: 5t50 B: [327755]
   automated match to d1hqla_
   complexed with ca, edo

Details for d5t50b_

PDB Entry: 5t50, 1.43 Å

PDB Description: ligand-free lectin from bauhinia forficata

PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d5t50b_:

Sequence; same for both SEQRES and ATOM records:

>d5t50b_ b.29.1.0 (B:) automated matches {Bauhinia forficata [TaxId: 413686]}
selsfnypnfqsveditfqggasprnetlqltptdsngipirqraghavysqpfqlrdts
fyttftfvirttsnspadgfaifiappdfpvkryggylglfepntatntsankvvavefd
twvntewkepryrhigidvnsivsvrvtrwqdkdvfsrsiatahvgydgiskiltafvty
pdggnyvlshvvdlaeifpgdvrigfsgatgqyetqyihswsfsststn

Timeline for d5t50b_:

• d5t50b_ is new in SCOPe 2.06-stable
  
• d5t50b_ appears in SCOPe 2.07
  
• d5t50b_ appears in the current release, SCOPe 2.08