Lineage for d1meka_ (1mek A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2131616Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2131617Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2131997Family c.47.1.2: PDI-like [52849] (3 proteins)
    duplication: contains two tandem repeats of this fold
  6. 2132010Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 2132020Species Human (Homo sapiens) [TaxId:9606] [52851] (3 PDB entries)
  8. 2132023Domain d1meka_: 1mek A: [32775]
    N-terminal domain

Details for d1meka_

PDB Entry: 1mek (more details)

PDB Description: human protein disulfide isomerase, nmr, 40 structures
PDB Compounds: (A:) protein disulfide isomerase

SCOPe Domain Sequences for d1meka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]}
dapeeedhvlvlrksnfaealaahkyllvefyapwcghckalapeyakaagklkaegsei
rlakvdateesdlaqqygvrgyptikffrngdtaspkeytagreaddivnwlkkrtgpaa

SCOPe Domain Coordinates for d1meka_:

Click to download the PDB-style file with coordinates for d1meka_.
(The format of our PDB-style files is described here.)

Timeline for d1meka_: