| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.33: Photosystem II 10 kDa phosphoprotein PsbH [161025] (2 families) ![]() automatically mapped to Pfam PF00737 |
| Family f.23.33.1: PsbH-like [161026] (2 proteins) Pfam PF00737 |
| Protein Photosystem II reaction center protein H, PsbH [161027] (2 species) |
| Species Thermosynechococcus elongatus [TaxId:146786] [161028] (8 PDB entries) Uniprot Q8DJ43 2-65 |
| Domain d5kaih_: 5kai h: [327741] Other proteins in same PDB: d5kaia_, d5kaib_, d5kaic_, d5kaid_, d5kaie_, d5kaif_, d5kaii1, d5kaii2, d5kaij_, d5kaik_, d5kail_, d5kaim1, d5kaim2, d5kaio_, d5kait1, d5kait2, d5kaiu_, d5kaiv_, d5kaix_, d5kaiz_ automated match to d4pj0h_ complexed with bcr, bct, cl, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, sqd, unl |
PDB Entry: 5kai (more details), 2.8 Å
SCOPe Domain Sequences for d5kaih_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kaih_ f.23.33.1 (h:) Photosystem II reaction center protein H, PsbH {Thermosynechococcus elongatus [TaxId: 146786]}
arrtwlgdilrplnseygkvapgwgttplmavfmglflvflliileiynstlildgvnvs
wka
Timeline for d5kaih_: