Lineage for d1bjx__ (1bjx -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 24115Fold c.47: Thioredoxin fold [52832] (3 superfamilies)
  4. 24116Superfamily c.47.1: Thioredoxin-like [52833] (10 families) (S)
  5. 24187Family c.47.1.2: PDI-like [52849] (2 proteins)
  6. 24192Protein Protein disulfide isomerase, PDI [52850] (2 species)
  7. 24193Species Human (Homo sapiens) [TaxId:9606] [52851] (3 PDB entries)
  8. 24194Domain d1bjx__: 1bjx - [32774]

Details for d1bjx__

PDB Entry: 1bjx (more details)

PDB Description: human protein disulfide isomerase, nmr, 24 structures
PDB Compounds: ( :)

SCOP Domain Sequences for d1bjx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjx__ c.47.1.2 (-) Protein disulfide isomerase, PDI {Human (Homo sapiens)}
aattlpdgaaaeslvessevavigffkdvesdsakqflqaaeaiddipfgitsnsdvfsk
yqldkdgvvlfkkfdegrnnfegevtkenlldfikhnqlplviefteqta

SCOP Domain Coordinates for d1bjx__:

Click to download the PDB-style file with coordinates for d1bjx__.
(The format of our PDB-style files is described here.)

Timeline for d1bjx__: